Lineage for d1nw2h_ (1nw2 H:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 991975Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 992037Protein Thioredoxin [52835] (14 species)
  7. 992038Species Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId:405212] [52839] (4 PDB entries)
    Uniprot P80579
  8. 992046Domain d1nw2h_: 1nw2 H: [92222]
    complexed with act, cac, zn; mutant

Details for d1nw2h_

PDB Entry: 1nw2 (more details), 1.9 Å

PDB Description: the crystal structure of the mutant r82e of thioredoxin from alicyclobacillus acidocaldarius
PDB Compounds: (H:) thioredoxin

SCOPe Domain Sequences for d1nw2h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nw2h_ c.47.1.1 (H:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]}
atmtltdanfqqaiqgdkpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden
pettsqfgimsiptlilfkggepvkqligyqpkeqleaqladvlq

SCOPe Domain Coordinates for d1nw2h_:

Click to download the PDB-style file with coordinates for d1nw2h_.
(The format of our PDB-style files is described here.)

Timeline for d1nw2h_: