Lineage for d1nw2f_ (1nw2 F:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1600409Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 1600473Protein Thioredoxin [52835] (15 species)
  7. 1600474Species Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId:405212] [52839] (4 PDB entries)
    Uniprot P80579
  8. 1600480Domain d1nw2f_: 1nw2 F: [92220]
    complexed with act, cac, zn; mutant

Details for d1nw2f_

PDB Entry: 1nw2 (more details), 1.9 Å

PDB Description: the crystal structure of the mutant r82e of thioredoxin from alicyclobacillus acidocaldarius
PDB Compounds: (F:) thioredoxin

SCOPe Domain Sequences for d1nw2f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nw2f_ c.47.1.1 (F:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]}
atmtltdanfqqaiqgdkpvlvdfwaawcgpcrmmapvleefaeahadkvtvaklnvden
pettsqfgimsiptlilfkggepvkqligyqpkeqleaqladvlq

SCOPe Domain Coordinates for d1nw2f_:

Click to download the PDB-style file with coordinates for d1nw2f_.
(The format of our PDB-style files is described here.)

Timeline for d1nw2f_: