Lineage for d1nvpc_ (1nvp C:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 957778Fold b.56: Transcription factor IIA (TFIIA), beta-barrel domain [50783] (1 superfamily)
    barrel, closed; n=6, S=12; mixed beta-sheet
  4. 957779Superfamily b.56.1: Transcription factor IIA (TFIIA), beta-barrel domain [50784] (1 family) (S)
    dimer of non-identical beta-sheet domains
  5. 957780Family b.56.1.1: Transcription factor IIA (TFIIA), beta-barrel domain [50785] (2 proteins)
    heterodimer of two homologous chains
  6. 957781Protein Large chain TOA1, C-terminal domain [88684] (2 species)
  7. 957785Species Human (Homo sapiens) [TaxId:9606] [101842] (1 PDB entry)
  8. 957786Domain d1nvpc_: 1nvp C: [92212]
    Other proteins in same PDB: d1nvpa1, d1nvpa2, d1nvpb_, d1nvpd1, d1nvpd2
    protein/DNA complex

Details for d1nvpc_

PDB Entry: 1nvp (more details), 2.1 Å

PDB Description: human tfiia/tbp/dna complex
PDB Compounds: (C:) Transcription initiation factor IIA beta chain

SCOPe Domain Sequences for d1nvpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nvpc_ b.56.1.1 (C:) Large chain TOA1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
dtenvvvcqydkihrsknkwkfhlkdgimnlngrdyifskaigdaew

SCOPe Domain Coordinates for d1nvpc_:

Click to download the PDB-style file with coordinates for d1nvpc_.
(The format of our PDB-style files is described here.)

Timeline for d1nvpc_: