Lineage for d1nu7d1 (1nu7 D:0-145)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 352714Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (6 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 352796Superfamily a.8.6: Staphylocoagulase [101094] (1 family) (S)
    duplication: consists of two domains of this fold
  5. 352797Family a.8.6.1: Staphylocoagulase [101095] (1 protein)
  6. 352798Protein Staphylocoagulase [101096] (1 species)
  7. 352799Species Staphylococcus aureus [TaxId:1280] [101097] (2 PDB entries)
  8. 352804Domain d1nu7d1: 1nu7 D:0-145 [92191]
    Other proteins in same PDB: d1nu7.1, d1nu7.2

Details for d1nu7d1

PDB Entry: 1nu7 (more details), 2.2 Å

PDB Description: Staphylocoagulase-Thrombin Complex

SCOP Domain Sequences for d1nu7d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nu7d1 a.8.6.1 (D:0-145) Staphylocoagulase {Staphylococcus aureus}
mivtkdyskesrvnenskygtlisdwylkgrltslesqfinalgiletyhygekeykdak
dklmtrilgedqyllerkkvqyeeykklykkykeenptskvkmktfdqytiedltmreyn
elteslksavkdfekdveiienqhhd

SCOP Domain Coordinates for d1nu7d1:

Click to download the PDB-style file with coordinates for d1nu7d1.
(The format of our PDB-style files is described here.)

Timeline for d1nu7d1: