Lineage for d1nu6b1 (1nu6 B:39-508)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 960620Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 960709Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
  5. 960710Family b.70.3.1: DPP6 N-terminal domain-like [82172] (2 proteins)
    Pfam PF00930
  6. 960717Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 960718Species Human (Homo sapiens) [TaxId:9606] [82174] (29 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 960736Domain d1nu6b1: 1nu6 B:39-508 [92187]
    Other proteins in same PDB: d1nu6a2, d1nu6b2
    complexed with hg, nag, ndg

Details for d1nu6b1

PDB Entry: 1nu6 (more details), 2.1 Å

PDB Description: crystal structure of human dipeptidyl peptidase iv (dpp-iv)
PDB Compounds: (B:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d1nu6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nu6b1 b.70.3.1 (B:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
srktytltdylkntyrlklyslrwisdheylykqennilvfnaeygnssvflenstfdef
ghsindysispdgqfilleynyvkqwrhsytasydiydlnkrqliteeripnntqwvtws
pvghklayvwnndiyvkiepnlpsyritwtgkediiyngitdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvrvpypkagavnptvkffvvntdslss
vtnatsiqitapasmligdhylcdvtwatqerislqwlrriqnysvmdicdydessgrwn
clvarqhiemsttgwvgrfrpsephftldgnsfykiisneegyrhicyfqidkkdctfit
kgtwevigiealtsdylyyisneykgmpggrnlykiqlsdytkvtclscelnpercqyys
vsfskeakyyqlrcsgpglplytlhssvndkglrvlednsaldkmlqnvq

SCOPe Domain Coordinates for d1nu6b1:

Click to download the PDB-style file with coordinates for d1nu6b1.
(The format of our PDB-style files is described here.)

Timeline for d1nu6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nu6b2