Lineage for d1nq4a_ (1nq4 A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 354640Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 354641Superfamily a.28.1: ACP-like [47336] (3 families) (S)
  5. 354642Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (5 proteins)
  6. 354662Protein Oxytetracycline polyketide synthase acyl carrier [101142] (1 species)
  7. 354663Species Streptomyces rimosus [TaxId:1927] [101143] (1 PDB entry)
  8. 354664Domain d1nq4a_: 1nq4 A: [92045]

Details for d1nq4a_

PDB Entry: 1nq4 (more details)

PDB Description: solution structure of oxytetracycline acyl carrier protein

SCOP Domain Sequences for d1nq4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nq4a_ a.28.1.1 (A:) Oxytetracycline polyketide synthase acyl carrier {Streptomyces rimosus}
mtlltlsdlltllrecageeesidlggdvedvafdalgydslallntvgrierdygvqlg
ddavekattpraliemtnasltgaspsaggaardk

SCOP Domain Coordinates for d1nq4a_:

Click to download the PDB-style file with coordinates for d1nq4a_.
(The format of our PDB-style files is described here.)

Timeline for d1nq4a_: