Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.1: YjgF-like [55298] (3 families) forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins) some members possess an endoribonuclease activity inhibiting mRNA translation |
Protein 14.5 kda translational inhibitor protein, L-PSP [89979] (3 species) mammalian tumor associated antigen UK114 |
Species Goat (Capra hircus) [TaxId:9925] [103077] (1 PDB entry) |
Domain d1nq3a_: 1nq3 A: [92039] |
PDB Entry: 1nq3 (more details), 2.2 Å
SCOPe Domain Sequences for d1nq3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nq3a_ d.79.1.1 (A:) 14.5 kda translational inhibitor protein, L-PSP {Goat (Capra hircus) [TaxId: 9925]} slvrriistakapaaigpysqavlvdrtiyisgqlgmdpasgqlvpggvveeakqaltni geilkaagcdftnvvkatvlladindfsavndvykqyfqssfparaayqvaalpkggrve ieaiavqgpltta
Timeline for d1nq3a_: