Lineage for d1nn8r_ (1nn8 R:)

  1. Root: SCOPe 2.02
  2. 1248417Class i: Low resolution protein structures [58117] (25 folds)
  3. 1249995Fold i.6: Viruses and virus-receptor complexes [58162] (1 superfamily)
  4. 1249996Superfamily i.6.1: Viruses and virus-receptor complexes [58163] (1 family) (S)
  5. 1249997Family i.6.1.1: Viruses and virus-receptor complexes [58164] (12 proteins)
  6. 1250105Protein Poliovirus complexed with three domain CD155 [58169] (1 species)
  7. 1250106Species Human poliovirus type 1 [TaxId:12080] [58170] (2 PDB entries)
  8. 1250111Domain d1nn8r_: 1nn8 R: [91999]
    complexed with myr

Details for d1nn8r_

PDB Entry: 1nn8 (more details), 15 Å

PDB Description: CryoEM structure of poliovirus receptor bound to poliovirus
PDB Compounds: (R:) poliovirus receptor

SCOPe Domain Sequences for d1nn8r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nn8r_ i.6.1.1 (R:) Poliovirus complexed with three domain CD155 {Human poliovirus type 1 [TaxId: 12080]}
vvvqaptqvpgflgdsvtlpcylqvpnmevthvsqltwarhgesgsmavfhqtqgpsyse
skrlefvaarlgaelrnaslrmfglrvedegnytclfvtfpqgsrsvdiwlrvlakpqnt
aevqkvqltgepvpmarcvstggrppaqitwhsdlggmpntsqvpgflsgtvtvtslwil
vpssqvdgknvtckvehesfekpqlltvnltvyyppevsisgydnnwylgqneatltcda
rsnpeptgynwsttmgplppfavaqgaqllirpvdkpinttlicnvtnalgarqaeltvq
v

SCOPe Domain Coordinates for d1nn8r_:

Click to download the PDB-style file with coordinates for d1nn8r_.
(The format of our PDB-style files is described here.)

Timeline for d1nn8r_: