Lineage for d1nmva1 (1nmv A:1-44)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 961395Fold b.72: WW domain-like [51044] (3 superfamilies)
    core: 3-stranded meander beta-sheet
  4. 961396Superfamily b.72.1: WW domain [51045] (1 family) (S)
  5. 961397Family b.72.1.1: WW domain [51046] (12 proteins)
  6. 961433Protein Mitotic rotamase PIN1 [51047] (1 species)
  7. 961434Species Human (Homo sapiens) [TaxId:9606] [51048] (8 PDB entries)
  8. 961439Domain d1nmva1: 1nmv A:1-44 [91993]
    Other proteins in same PDB: d1nmva2

Details for d1nmva1

PDB Entry: 1nmv (more details)

PDB Description: solution structure of human pin1
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d1nmva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmva1 b.72.1.1 (A:1-44) Mitotic rotamase PIN1 {Human (Homo sapiens) [TaxId: 9606]}
madeeklppgwekrmsrssgrvyyfnhitnasqwerpsgnsssg

SCOPe Domain Coordinates for d1nmva1:

Click to download the PDB-style file with coordinates for d1nmva1.
(The format of our PDB-style files is described here.)

Timeline for d1nmva1:

961439
d1nmva1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d1nmva2