Lineage for d1nmra1 (1nmr A:3-85)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017239Fold a.144: PABP domain-like [63569] (2 superfamilies)
    4 helices; an orthogonal array
  4. 2017240Superfamily a.144.1: PABC (PABP) domain [63570] (2 families) (S)
  5. 2017241Family a.144.1.1: PABC (PABP) domain [63571] (3 proteins)
  6. 2017245Protein poly(A) binding protein [63572] (3 species)
  7. 2017252Species Trypanosoma cruzi [TaxId:5693] [101231] (1 PDB entry)
  8. 2017253Domain d1nmra1: 1nmr A:3-85 [91992]
    Other proteins in same PDB: d1nmra2

Details for d1nmra1

PDB Entry: 1nmr (more details)

PDB Description: solution structure of c-terminal domain from trypanosoma cruzi poly(a)-binding protein
PDB Compounds: (A:) poly(A)-binding protein

SCOPe Domain Sequences for d1nmra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmra1 a.144.1.1 (A:3-85) poly(A) binding protein {Trypanosoma cruzi [TaxId: 5693]}
slasqgqnlstvlanltpeqqknvlgerlynhivainpaaaakvtgmllemdngeilnll
dtpglldakvqealevlnrhmnv

SCOPe Domain Coordinates for d1nmra1:

Click to download the PDB-style file with coordinates for d1nmra1.
(The format of our PDB-style files is described here.)

Timeline for d1nmra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nmra2