![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.8: Putative Holliday junction resolvase RuvX [102485] (3 proteins) automatically mapped to Pfam PF03652 |
![]() | Protein Hypothetical protein YqgF (RuvX) [102486] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [102487] (3 PDB entries) |
![]() | Domain d1nmna_: 1nmn A: [91978] structural genomics |
PDB Entry: 1nmn (more details), 2.3 Å
SCOPe Domain Sequences for d1nmna_:
Sequence, based on SEQRES records: (download)
>d1nmna_ c.55.3.8 (A:) Hypothetical protein YqgF (RuvX) {Escherichia coli [TaxId: 562]} sgtllafdfgtksigvavgqritgtarplpaikaqdgtpdwniierllkewqpdeiivgl plnmdgteqpltararkfanrihgrfgvevklhderlstvearsglfeqggyralnkgkv dsasaviilesyfeqgy
>d1nmna_ c.55.3.8 (A:) Hypothetical protein YqgF (RuvX) {Escherichia coli [TaxId: 562]} sgtllafdfgtksigvavgqritgtarplpaikaqdgtpdwniierllkewqpdeiivgl plnmdgteqpltararkfanrihgrfgvevklhderlstvgkvdsasaviilesyfeqgy
Timeline for d1nmna_: