Lineage for d1nmna_ (1nmn A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1859086Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1860089Family c.55.3.8: Putative Holliday junction resolvase RuvX [102485] (3 proteins)
    automatically mapped to Pfam PF03652
  6. 1860090Protein Hypothetical protein YqgF (RuvX) [102486] (1 species)
  7. 1860091Species Escherichia coli [TaxId:562] [102487] (3 PDB entries)
  8. 1860094Domain d1nmna_: 1nmn A: [91978]
    structural genomics

Details for d1nmna_

PDB Entry: 1nmn (more details), 2.3 Å

PDB Description: Structure of yqgF from Escherichia coli, a hypothetical protein
PDB Compounds: (A:) Hypothetical protein yqgF

SCOPe Domain Sequences for d1nmna_:

Sequence, based on SEQRES records: (download)

>d1nmna_ c.55.3.8 (A:) Hypothetical protein YqgF (RuvX) {Escherichia coli [TaxId: 562]}
sgtllafdfgtksigvavgqritgtarplpaikaqdgtpdwniierllkewqpdeiivgl
plnmdgteqpltararkfanrihgrfgvevklhderlstvearsglfeqggyralnkgkv
dsasaviilesyfeqgy

Sequence, based on observed residues (ATOM records): (download)

>d1nmna_ c.55.3.8 (A:) Hypothetical protein YqgF (RuvX) {Escherichia coli [TaxId: 562]}
sgtllafdfgtksigvavgqritgtarplpaikaqdgtpdwniierllkewqpdeiivgl
plnmdgteqpltararkfanrihgrfgvevklhderlstvgkvdsasaviilesyfeqgy

SCOPe Domain Coordinates for d1nmna_:

Click to download the PDB-style file with coordinates for d1nmna_.
(The format of our PDB-style files is described here.)

Timeline for d1nmna_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1nmnb_