SCOP 1.67: Domain d1nmna_: 1nmn A:

Lineage for d1nmna_ (1nmn A:)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (9 families)
   consists of one domain of this fold

5. Family c.55.3.8: Putative Holliday junction resolvase RuvX [102485] (3 proteins)

6. Protein Hypothetical protein YqgF (RuvX) [102486] (1 species)

7. Species Escherichia coli [TaxId:562] [102487] (3 PDB entries)

8. Domain d1nmna_: 1nmn A: [91978]

Details for d1nmna_

PDB Entry: 1nmn, 2.3 Å

PDB Description: Structure of yqgF from Escherichia coli, a hypothetical protein

SCOP Domain Sequences for d1nmna_:

Sequence, based on SEQRES records:

>d1nmna_ c.55.3.8 (A:) Hypothetical protein YqgF (RuvX) {Escherichia coli}
sgtllafdfgtksigvavgqritgtarplpaikaqdgtpdwniierllkewqpdeiivgl
plnmdgteqpltararkfanrihgrfgvevklhderlstvearsglfeqggyralnkgkv
dsasaviilesyfeqgy

Sequence, based on observed residues (ATOM records):

>d1nmna_ c.55.3.8 (A:) Hypothetical protein YqgF (RuvX) {Escherichia coli}
sgtllafdfgtksigvavgqritgtarplpaikaqdgtpdwniierllkewqpdeiivgl
plnmdgteqpltararkfanrihgrfgvevklhderlstvgkvdsasaviilesyfeqgy

Timeline for d1nmna_:

• d1nmna_ is new in SCOP 1.67
  
• d1nmna_ appears in SCOP 1.69
  
• d1nmna_ appears in the current release, SCOPe 2.08