SCOPe 2.08: Domain d1nmla1: 1nml A:1-166

Lineage for d1nmla1 (1nml A:1-166)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.5: Di-heme cytochrome c peroxidase [46685] (1 protein)
   duplication: contains two cytochrome c-type domains

6. Protein Di-heme cytochrome c peroxidase [46686] (3 species)

7. Species Pseudomonas nautica [TaxId:2743] [100993] (3 PDB entries)
   Uniprot P83787

8. Domain d1nmla1: 1nml A:1-166 [91976]
   complexed with cit, hec

Details for d1nmla1

PDB Entry: 1nml, 2.2 Å

PDB Description: di-haemic cytochrome c peroxidase from pseudomonas nautica 617, form in (ph 4.0)

PDB Compounds: (A:) di-haem cytochrome c peroxidase

SCOPe Domain Sequences for d1nmla1:

Sequence; same for both SEQRES and ATOM records:

>d1nmla1 a.3.1.5 (A:1-166) Di-heme cytochrome c peroxidase {Pseudomonas nautica [TaxId: 2743]}
dnlmeransmfepipkyppvidgneltqakvelgkmeffeprlssshliscntchnvglg
gddelptsighgwqkgprnsptvfnavfnaaqfwdgraadlaeqakgpvqagvemsstpd
rvvatlksmpeyierfedafpgqenpvtfdnmavaieayeatlitp

Timeline for d1nmla1:

• d1nmla1 first appeared in SCOP 1.67
  
• d1nmla1 appears in SCOPe 2.07