![]() | Class g: Small proteins [56992] (90 folds) |
![]() | Fold g.54: DnaJ/Hsp40 cysteine-rich domain [57937] (1 superfamily) metal(zinc)-bound extended beta-hairpin fold |
![]() | Superfamily g.54.1: DnaJ/Hsp40 cysteine-rich domain [57938] (1 family) ![]() |
![]() | Family g.54.1.1: DnaJ/Hsp40 cysteine-rich domain [57939] (2 proteins) |
![]() | Protein Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain [103634] (1 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [103635] (1 PDB entry) |
![]() | Domain d1nlta3: 1nlt A:139-212 [91965] Other proteins in same PDB: d1nlta1, d1nlta2 complexed with zn2; mutant |
PDB Entry: 1nlt (more details), 2.7 Å
SCOP Domain Sequences for d1nlta3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nlta3 g.54.1.1 (A:139-212) Mitochondrial protein import protein mas5 (Hsp40, Ydj1), insert domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} kqilckecegrggkkgavkkctscngqgikfvtrqmgpmiqrfqtecdvchgtgdiidpk drckscngkkvene
Timeline for d1nlta3: