Lineage for d1nl2a1 (1nl2 A:66-146)
- Root: SCOPe 2.08
Class g: Small proteins [56992] (100 folds) 
Fold g.14: Kringle-like [57439] (1 superfamily)
disulfide-rich fold; nearly all-betaSuperfamily g.14.1: Kringle-like [57440] (3 families) 
Family g.14.1.1: Kringle modules [57441] (7 proteins) 
Protein Prothrombin [57448] (1 species) Species Cow (Bos taurus) [TaxId:9913] [57449] (5 PDB entries) 
Domain d1nl2a1: 1nl2 A:66-146 [91951]
Other proteins in same PDB: d1nl2a2
complexed with ca, cl, lps, nag
Details for d1nl2a1
PDB Entry: 1nl2 (more details), 2.3 Å
PDB Description: bovine prothrombin fragment 1 in complex with calcium and lysophosphotidylserine
PDB Compounds: (A:) ProthrombinSCOPe Domain Sequences for d1nl2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nl2a1 g.14.1.1 (A:66-146) Prothrombin {Cow (Bos taurus) [TaxId: 9913]}
caegvgmnyrgnvsvtrsgiecqlwrsryphkpeinstthpgadlrenfcrnpdgsitgp
wcyttsptlrreecsvpvcgq
SCOPe Domain Coordinates for d1nl2a1:
Click to download the PDB-style file with coordinates for d1nl2a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nl2a1:
- d1nl2a1 first appeared in SCOP 1.67
- d1nl2a1 appears in SCOPe 2.07
View in 3D
