![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
![]() | Superfamily g.14.1: Kringle-like [57440] (3 families) ![]() |
![]() | Family g.14.1.1: Kringle modules [57441] (7 proteins) |
![]() | Protein Prothrombin [57448] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [57449] (5 PDB entries) |
![]() | Domain d1nl2a1: 1nl2 A:66-146 [91951] Other proteins in same PDB: d1nl2a2 complexed with ca, cl, lps, nag |
PDB Entry: 1nl2 (more details), 2.3 Å
SCOPe Domain Sequences for d1nl2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nl2a1 g.14.1.1 (A:66-146) Prothrombin {Cow (Bos taurus) [TaxId: 9913]} caegvgmnyrgnvsvtrsgiecqlwrsryphkpeinstthpgadlrenfcrnpdgsitgp wcyttsptlrreecsvpvcgq
Timeline for d1nl2a1: