| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (10 families) ![]() consists of one domain of this fold |
| Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (7 proteins) |
| Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species) part of Klenow fragment, KF |
| Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (31 PDB entries) |
| Domain d1njza1: 1njz A:297-468 [91919] Other proteins in same PDB: d1njza2 |
PDB Entry: 1njz (more details), 2 Å
SCOP Domain Sequences for d1njza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1njza1 c.55.3.5 (A:297-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed}
akmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn
Timeline for d1njza1: