Lineage for d1ne9a2 (1ne9 A:165-335)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1037211Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1037212Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1037635Family d.108.1.4: FemXAB nonribosomal peptidyltransferases [82749] (3 proteins)
    duplication: consists of two NAT-like domains swapped with the C-terminal strands
  6. 1037646Protein Peptidyltransferase FemX [103177] (1 species)
  7. 1037647Species Weissella viridescens [TaxId:1629] [103178] (5 PDB entries)
  8. 1037649Domain d1ne9a2: 1ne9 A:165-335 [91840]
    complexed with mg

Details for d1ne9a2

PDB Entry: 1ne9 (more details), 1.7 Å

PDB Description: Crystal Structure of Weissella viridescens FemX at 1.7 Ang Resolution
PDB Compounds: (A:) FemX

SCOPe Domain Sequences for d1ne9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ne9a2 d.108.1.4 (A:165-335) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]}
ypsktkskikrpfrdgvevhsgnsateldeffktyttmaerhgithrpieyfqrmqaafd
adtmrifvaeregkllstgialkygrkiwymyagsmdgntyyapyavqsemiqwaldtnt
dlydlggiesestddslyvfkhvfvkdapreyigeidkvldpevyaelvkd

SCOPe Domain Coordinates for d1ne9a2:

Click to download the PDB-style file with coordinates for d1ne9a2.
(The format of our PDB-style files is described here.)

Timeline for d1ne9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ne9a1