SCOPe 2.06: Domain d1ne7e_: 1ne7 E:

Lineage for d1ne7e_ (1ne7 E:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families)

5. Family c.124.1.1: NagB-like [52513] (3 proteins)
   share a common phosphate-binding site with the RpiA family

6. Protein Glucosamine 6-phosphate deaminase/isomerase NagB [52514] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102320] (2 PDB entries)

8. Domain d1ne7e_: 1ne7 E: [91837]
   complexed with 16g, agp, glc, so4

Details for d1ne7e_

PDB Entry: 1ne7, 1.75 Å

PDB Description: human glucosamine-6-phosphate deaminase isomerase at 1.75 a resolution complexed with n-acetyl-glucosamine-6-phosphate and 2-deoxy-2-amino- glucitol-6-phosphate

PDB Compounds: (E:) Glucosamine-6-phosphate isomerase

SCOPe Domain Sequences for d1ne7e_:

Sequence; same for both SEQRES and ATOM records:

>d1ne7e_ c.124.1.1 (E:) Glucosamine 6-phosphate deaminase/isomerase NagB {Human (Homo sapiens) [TaxId: 9606]}
mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
edatlelkvktvkyfkglmlvhnklvdplysike

Timeline for d1ne7e_:

• d1ne7e_ first appeared in SCOP 1.67
  
• d1ne7e_ appears in SCOPe 2.05
  
• d1ne7e_ appears in SCOPe 2.07
  
• d1ne7e_ appears in the current release, SCOPe 2.08