Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.9: Metallo-dependent hydrolases [51556] (18 families) the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
Family c.1.9.1: Adenosine/AMP deaminase [51557] (2 proteins) |
Protein Adenosine deaminase (ADA) [51558] (3 species) Common fold covers the whole protein structure |
Species Cow (Bos taurus) [TaxId:9913] [82257] (17 PDB entries) Uniprot P56658 3-350 Uniprot P56658 Uniprot P56658 3-350 ! Uniprot P56658 |
Domain d1ndva_: 1ndv A: [91824] complexed with fr0, zn |
PDB Entry: 1ndv (more details), 2.3 Å
SCOP Domain Sequences for d1ndva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ndva_ c.1.9.1 (A:) Adenosine deaminase (ADA) {Cow (Bos taurus) [TaxId: 9913]} tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeelqniigmdkpltlpdfla kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayr
Timeline for d1ndva_: