Lineage for d1ndqa_ (1ndq A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1598715Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 1598716Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 1598717Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 1598785Protein Subtilisin [52745] (6 species)
  7. 1598841Species Bacillus lentus [TaxId:1467] [52750] (9 PDB entries)
  8. 1598849Domain d1ndqa_: 1ndq A: [91822]
    complexed with ca

Details for d1ndqa_

PDB Entry: 1ndq (more details), 1.8 Å

PDB Description: bacillus lentus subtilisin
PDB Compounds: (A:) Subtilisin Savinase

SCOPe Domain Sequences for d1ndqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ndqa_ c.41.1.1 (A:) Subtilisin {Bacillus lentus [TaxId: 1467]}
aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
ghgthvagtiaalnnsigvlgvapsaelyavkvlgasgsgsvssiaqglewagnngmhva
nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi
rnhlkntatslgstnlygsglvnaeaatr

SCOPe Domain Coordinates for d1ndqa_:

Click to download the PDB-style file with coordinates for d1ndqa_.
(The format of our PDB-style files is described here.)

Timeline for d1ndqa_: