SCOPe 2.03: Domain d1naqb_: 1naq B:

Lineage for d1naqb_ (1naq B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)

6. Protein Cut A1 [89931] (5 species)

7. Species Escherichia coli [TaxId:562] [102973] (4 PDB entries)

8. Domain d1naqb_: 1naq B: [91762]
   complexed with hg, mbo

Details for d1naqb_

PDB Entry: 1naq, 1.7 Å

PDB Description: crystal structure of cuta1 from e.coli at 1.7 a resolution

PDB Compounds: (B:) Periplasmic divalent cation tolerance protein cutA

SCOPe Domain Sequences for d1naqb_:

Sequence; same for both SEQRES and ATOM records:

>d1naqb_ d.58.5.2 (B:) Cut A1 {Escherichia coli [TaxId: 562]}
tasvvvlctapdeataqdlaakvlaeklaacatlipgatslyywegkleqeyevqmilkt
tvshqqalleclkshhpyqtpellvlpvthgdtdylswlnasl

Timeline for d1naqb_:

• d1naqb_ first appeared in SCOP 1.67
  
• d1naqb_ appears in SCOPe 2.02
  
• d1naqb_ appears in SCOPe 2.04
  
• d1naqb_ appears in the current release, SCOPe 2.08