Lineage for d1naqb_ (1naq B:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 411877Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 412166Superfamily d.58.5: GlnB-like [54913] (4 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 412197Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (3 proteins)
  6. 412198Protein Cut A1 [89931] (4 species)
  7. 412204Species Escherichia coli [TaxId:562] [102973] (1 PDB entry)
  8. 412206Domain d1naqb_: 1naq B: [91762]

Details for d1naqb_

PDB Entry: 1naq (more details), 1.7 Å

PDB Description: crystal structure of cuta1 from e.coli at 1.7 a resolution

SCOP Domain Sequences for d1naqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1naqb_ d.58.5.2 (B:) Cut A1 {Escherichia coli}
tasvvvlctapdeataqdlaakvlaeklaacatlipgatslyywegkleqeyevqmilkt
tvshqqalleclkshhpyqtpellvlpvthgdtdylswlnasl

SCOP Domain Coordinates for d1naqb_:

Click to download the PDB-style file with coordinates for d1naqb_.
(The format of our PDB-style files is described here.)

Timeline for d1naqb_: