Lineage for d1na7a_ (1na7 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 511959Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 511960Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 512001Family d.144.1.7: Protein kinases, catalytic subunit [88854] (53 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 512448Protein Protein kinase CK2, alpha subunit [56142] (2 species)
    CMGC group; CK2 subfamily; serine/threonine kinase
  7. 512449Species Human (Homo sapiens) [TaxId:9606] [75559] (3 PDB entries)
  8. 512450Domain d1na7a_: 1na7 A: [91752]

Details for d1na7a_

PDB Entry: 1na7 (more details), 2.4 Å

PDB Description: crystal structure of the catalytic subunit of human protein kinase ck2

SCOP Domain Sequences for d1na7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1na7a_ d.144.1.7 (A:) Protein kinase CK2, alpha subunit {Human (Homo sapiens)}
pvpsrarvytdvnthrpreywdyashvvewgnqddyqlvrklgrgkysevfeainitnne
kvvvkilkpvkknkikreikilenlrggpniitladivkdpvsrtpalvfehvnntdfkq
lyqtltdydirfymyeilkaldychsmgimhrdvkphnvmidhehrklrlidwglaefyh
pgqeynvrvasryfkgpellvdyqmydysldmwslgcmlasmifrkepffhghdnydqlv
riakvlgtedlydyidkynieldprfndilgrhsrkrwerfvhsenqhlvspealdfldk
llrydhqsrltareamehpyfytvvk

SCOP Domain Coordinates for d1na7a_:

Click to download the PDB-style file with coordinates for d1na7a_.
(The format of our PDB-style files is described here.)

Timeline for d1na7a_: