Lineage for d1na6b2 (1na6 B:183-402)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1856505Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1856506Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) (S)
  5. 1856861Family c.52.1.22: Type II restriction endonuclease catalytic domain [102474] (1 protein)
  6. 1856862Protein Restriction endonuclease EcoRII, C-terminal domain [102475] (1 species)
  7. 1856863Species Escherichia coli [TaxId:562] [102476] (1 PDB entry)
  8. 1856865Domain d1na6b2: 1na6 B:183-402 [91751]
    Other proteins in same PDB: d1na6a1, d1na6b1
    mutant

Details for d1na6b2

PDB Entry: 1na6 (more details), 2.1 Å

PDB Description: crystal structure of restriction endonuclease ecorii mutant r88a
PDB Compounds: (B:) Restriction endonuclease EcoRII

SCOPe Domain Sequences for d1na6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1na6b2 c.52.1.22 (B:183-402) Restriction endonuclease EcoRII, C-terminal domain {Escherichia coli [TaxId: 562]}
yilpedwhlrfpsgseiiqyaashyvknsldpdeqlldrrrveydifllveelhvldiir
kgfgsvdefialansvsnrrksragkslelhlehlfiehglrhfatqaitegnkkpdflf
psagayhdtefpvenlrmlavkttckdrwrqilneadkihqvhlftlqegvslaqyremr
esgvrlvvpsslhkkypeavraelmtlgafiaeltglyad

SCOPe Domain Coordinates for d1na6b2:

Click to download the PDB-style file with coordinates for d1na6b2.
(The format of our PDB-style files is described here.)

Timeline for d1na6b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1na6b1