![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) ![]() |
![]() | Family c.52.1.22: Type II restriction endonuclease catalytic domain [102474] (1 protein) |
![]() | Protein Restriction endonuclease EcoRII, C-terminal domain [102475] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [102476] (1 PDB entry) |
![]() | Domain d1na6b2: 1na6 B:183-402 [91751] Other proteins in same PDB: d1na6a1, d1na6b1 mutant |
PDB Entry: 1na6 (more details), 2.1 Å
SCOPe Domain Sequences for d1na6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1na6b2 c.52.1.22 (B:183-402) Restriction endonuclease EcoRII, C-terminal domain {Escherichia coli [TaxId: 562]} yilpedwhlrfpsgseiiqyaashyvknsldpdeqlldrrrveydifllveelhvldiir kgfgsvdefialansvsnrrksragkslelhlehlfiehglrhfatqaitegnkkpdflf psagayhdtefpvenlrmlavkttckdrwrqilneadkihqvhlftlqegvslaqyremr esgvrlvvpsslhkkypeavraelmtlgafiaeltglyad
Timeline for d1na6b2: