SCOPe 2.08: Domain d1n82a_: 1n82 A:

Lineage for d1n82a_ (1n82 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.3: beta-glycanases [51487] (27 proteins)
   consist of a number of sequence families

6. Protein Xylanase [51488] (6 species)

7. Species Bacillus stearothermophilus, Ixt6 [TaxId:1422] [102063] (7 PDB entries)
   intra-cellular xylanase

8. Domain d1n82a_: 1n82 A: [91703]
   complexed with gol, na

Details for d1n82a_

PDB Entry: 1n82, 1.45 Å

PDB Description: the high-resolution crystal structure of ixt6, a thermophilic, intracellular xylanase from g. stearothermophilus

PDB Compounds: (A:) intra-cellular xylanase

SCOPe Domain Sequences for d1n82a_:

Sequence; same for both SEQRES and ATOM records:

>d1n82a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]}
nsslpslrdvfandfrigaavnpvtiemqkqllidhvnsitaenhmkfehlqpeegkftf
qeadrivdfacshrmavrghtlvwhnqtpdwvfqdgqghfvsrdvllermkchistvvrr
ykgkiycwdvineavadegdellrpskwrqiigddfmeqaflyayeadpdallfyndyne
cfpekrekifalvkslrdkgipihgigmqahwsltrpsldeiraaieryaslgvvlhite
ldvsmfefhdrrtdlaaptsemierqaerygqifalfkeyrdviqsvtfwgiaddhtwld
nfpvhgrknwpllfdeqhkpkpafwravsv

Timeline for d1n82a_:

• d1n82a_ first appeared in SCOP 1.67
  
• d1n82a_ appears in SCOPe 2.07