Lineage for d1n4pa_ (1n4p A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2010398Superfamily a.118.6: Protein prenylyltransferase [48439] (2 families) (S)
  5. 2010399Family a.118.6.1: Protein prenylyltransferase [48440] (3 proteins)
  6. 2010400Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 2010415Species Norway rat (Rattus norvegicus) [TaxId:10116] [48442] (51 PDB entries)
    Uniprot Q04631 55-369
  8. 2010483Domain d1n4pa_: 1n4p A: [91623]
    Other proteins in same PDB: d1n4pb_, d1n4pd_, d1n4pf_, d1n4ph_, d1n4pj_, d1n4pl_
    complexed with cl, ger, grg, zn

Details for d1n4pa_

PDB Entry: 1n4p (more details), 2.65 Å

PDB Description: protein geranylgeranyltransferase type-i complexed with geranylgeranyl diphosphate
PDB Compounds: (A:) protein farnesyltransferase alpha subunit

SCOPe Domain Sequences for d1n4pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n4pa_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Norway rat (Rattus norvegicus) [TaxId: 10116]}
flsldsptyvlyrdraewadidpvpqndgpspvvqiiysekfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllrslqkdlqeemnyiiaiieeqpknyqvwhhrrv
lvewlkdpsqelefiadilnqdaknyhawqhrqwviqefrlwdnelqyvdqllkedvrnn
svwnqrhfvisnttgysdravlerevqytlemiklvphnesawnylkgilqdrglsrypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhs

SCOPe Domain Coordinates for d1n4pa_:

Click to download the PDB-style file with coordinates for d1n4pa_.
(The format of our PDB-style files is described here.)

Timeline for d1n4pa_: