SCOP 1.71: Domain d1n4oa_: 1n4o A:

Lineage for d1n4oa_ (1n4o A:)

1. Root: SCOP 1.71

2. Class e: Multi-domain proteins (alpha and beta) [56572] (48 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (13 proteins)

6. Protein beta-Lactamase, class A [56606] (15 species)

7. Species Stenotrophomonas maltophilia, L2 [TaxId:40324] [103374] (2 PDB entries)

8. Domain d1n4oa_: 1n4o A: [91621]

Details for d1n4oa_

PDB Entry: 1n4o, 1.85 Å

PDB Description: Crystal structure of the Class A beta-lactamase L2 from Stenotrophomonas maltophilia

SCOP Domain Sequences for d1n4oa_:

Sequence; same for both SEQRES and ATOM records:

>d1n4oa_ e.3.1.1 (A:) beta-Lactamase, class A {Stenotrophomonas maltophilia, L2}
tdaaitaasdfaalekacagrlgvtlldtasgrrighrqderfpmcstfksmlaatvlsq
aermpalldrrvpvgeadllshapvtrrhagkdmtvrdlcratiitsdntaanllfgvvg
gppavtaflrasgdtvsrsdrlepelnsfakgdprdtttpaamaatlqrvvlgevlqpas
rqqladwlidnetgdaclraglgkrwrvgdktgsngedarndiavlwpvaggapwvltay
lqagaisyeqrasvlaqvgriadrlig

Timeline for d1n4oa_:

• d1n4oa_ first appeared in SCOP 1.67
  
• d1n4oa_ appears in SCOP 1.69
  
• d1n4oa_ appears in SCOP 1.73
  
• d1n4oa_ appears in the current release, SCOPe 2.08