![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins) Pfam PF00640 |
![]() | Protein Shc adaptor protein [50760] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50761] (3 PDB entries) |
![]() | Domain d1n3ha_: 1n3h A: [91564] has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1n3h (more details)
SCOPe Domain Sequences for d1n3ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n3ha_ b.55.1.2 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} mnklsggggrrtrveggqlggeewtrhgsfvnkptrgwlhpndkvmgpgvsylvrymgcv evlqsmraldfntrtqvtreaislvceavpgakgatrrrkpcsrplssilgrsnlkfagm pitltvstsslnlmaadckqiianhhmqsisfasggdpdtaeyvayvakdpvnqrachil ecpeglaqdvistigqafelrfkqylr
Timeline for d1n3ha_: