Lineage for d1n3ha_ (1n3h A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2394380Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2394381Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2394657Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 protein domains)
    Pfam PF00640
  6. 2394709Protein Shc adaptor protein [50760] (1 species)
  7. 2394710Species Human (Homo sapiens) [TaxId:9606] [50761] (3 PDB entries)
  8. 2394712Domain d1n3ha_: 1n3h A: [91564]

Details for d1n3ha_

PDB Entry: 1n3h (more details)

PDB Description: Coupling of Folding and Binding in the PTB Domain of the Signaling Protein Shc
PDB Compounds: (A:) SHC Transforming protein

SCOPe Domain Sequences for d1n3ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n3ha_ b.55.1.2 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]}
mnklsggggrrtrveggqlggeewtrhgsfvnkptrgwlhpndkvmgpgvsylvrymgcv
evlqsmraldfntrtqvtreaislvceavpgakgatrrrkpcsrplssilgrsnlkfagm
pitltvstsslnlmaadckqiianhhmqsisfasggdpdtaeyvayvakdpvnqrachil
ecpeglaqdvistigqafelrfkqylr

SCOPe Domain Coordinates for d1n3ha_:

Click to download the PDB-style file with coordinates for d1n3ha_.
(The format of our PDB-style files is described here.)

Timeline for d1n3ha_: