Lineage for d1n1dd_ (1n1d D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590100Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1590370Family c.26.1.2: Cytidylyltransferase [52394] (2 proteins)
    automatically mapped to Pfam PF01467
  6. 1590371Protein CTP:glycerol-3-phosphate cytidylyltransferase [52395] (1 species)
  7. 1590372Species Bacillus subtilis [TaxId:1423] [52396] (2 PDB entries)
  8. 1590378Domain d1n1dd_: 1n1d D: [91541]
    complexed with c2g, so4

Details for d1n1dd_

PDB Entry: 1n1d (more details), 2 Å

PDB Description: Glycerol-3-phosphate cytidylyltransferase complexed with CDP-glycerol
PDB Compounds: (D:) glycerol-3-phosphate cytidylyltransferase

SCOPe Domain Sequences for d1n1dd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n1dd_ c.26.1.2 (D:) CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus subtilis [TaxId: 1423]}
mkkvitygtfdllhwghikllerakqlgdylvvaistdefnlqkqkkayhsyehrklile
tiryvdevipeknweqkkqdiidhnidvfvmgddwegkfdflkdqcevvylprtegistt
kikeei

SCOPe Domain Coordinates for d1n1dd_:

Click to download the PDB-style file with coordinates for d1n1dd_.
(The format of our PDB-style files is described here.)

Timeline for d1n1dd_: