Class b: All beta proteins [48724] (141 folds) |
Fold b.129: MazE/MraZ-like [89446] (1 superfamily) pseudobarrel; capped on both ends by alpha-helices |
Superfamily b.129.1: MazE/MraZ-like [89447] (2 families) members of this superfamily are known or predicted to have DNA-binding function |
Family b.129.1.2: Hypothetical protein MraZ [102020] (1 protein) duplication: contains two interlocking repeats of similar sequence arranged as subunits in the MazE homodimer |
Protein Hypothetical protein MraZ [102021] (1 species) |
Species Mycoplasma preumoniae [102022] (3 PDB entries) |
Domain d1n0fg_: 1n0f G: [91522] |
PDB Entry: 1n0f (more details), 2.8 Å
SCOP Domain Sequences for d1n0fg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n0fg_ b.129.1.2 (G:) Hypothetical protein MraZ {Mycoplasma preumoniae} mllgtfnitldaknrislpaklraffegsivinrgfenclevrkpqdfqkyfeqfnsfps tqkdtrtlkrlifananfvdvdtagrvlipnnlindakldkeivligqfdhleiwdkkly edylansesletvaerm
Timeline for d1n0fg_: