| Class b: All beta proteins [48724] (180 folds) |
| Fold b.129: Double-split beta-barrel [89446] (2 superfamilies) pseudobarrel; capped on both ends by alpha-helices |
Superfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families) ![]() members of this superfamily are known or predicted to have DNA-binding function |
| Family b.129.1.2: Hypothetical protein MraZ [102020] (1 protein) duplication: contains two interlocking repeats of similar sequence arranged as subunits in the MazE homodimer |
| Protein Hypothetical protein MraZ [102021] (1 species) |
| Species Mycoplasma pneumoniae [TaxId:2104] [102022] (3 PDB entries) |
| Domain d1n0fg_: 1n0f G: [91522] Other proteins in same PDB: d1n0fa2, d1n0fb2 structural genomics |
PDB Entry: 1n0f (more details), 2.8 Å
SCOPe Domain Sequences for d1n0fg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n0fg_ b.129.1.2 (G:) Hypothetical protein MraZ {Mycoplasma pneumoniae [TaxId: 2104]}
mllgtfnitldaknrislpaklraffegsivinrgfenclevrkpqdfqkyfeqfnsfps
tqkdtrtlkrlifananfvdvdtagrvlipnnlindakldkeivligqfdhleiwdkkly
edylansesletvaerm
Timeline for d1n0fg_: