SCOPe 2.04: Domain d1mzva_: 1mzv A:

Lineage for d1mzva_ (1mzv A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Adenine PRTase [53288] (5 species)

7. Species Leishmania tarentolae [TaxId:5689] [102535] (1 PDB entry)

8. Domain d1mzva_: 1mzv A: [91502]
   complexed with amp, po4

Details for d1mzva_

PDB Entry: 1mzv, 2.2 Å

PDB Description: Crystal Structure of Adenine Phosphoribosyltransferase (APRT) From Leishmania tarentolae

PDB Compounds: (A:) Adenine phosphoribosyltransferase

SCOPe Domain Sequences for d1mzva_:

Sequence; same for both SEQRES and ATOM records:

>d1mzva_ c.61.1.1 (A:) Adenine PRTase {Leishmania tarentolae [TaxId: 5689]}
slkeigpnsllledshslsqllkknyrwyspifsprnvprfadvssitespetlkairdf
lveryrtmspapthilgfdargflfgpmiavelgipfvlmrkadknagllirsepyekey
keaapevmtirhgsigknsrvvliddvlatggtalsglqlveasgaevvemvsiltipfl
kaaerihstaggryknvrfigllsedvlteancgdl

Timeline for d1mzva_:

• d1mzva_ first appeared in SCOP 1.67
  
• d1mzva_ appears in SCOPe 2.03
  
• d1mzva_ appears in SCOPe 2.05
  
• d1mzva_ appears in the current release, SCOPe 2.08