Lineage for d1mw5b_ (1mw5 B:)
- Root: SCOP 1.69
Class d: Alpha and beta proteins (a+b) [53931] (279 folds) 
Fold d.259: Hypothetical protein HI1480 [103276] (1 superfamily)
beta-alpha(4)-beta-alpha-beta; segregated alpha-helical and beta-sheet subdomains; dimeric beta-sheet barrel: n=6, S=10Superfamily d.259.1: Hypothetical protein HI1480 [103277] (1 family) 
Family d.259.1.1: Hypothetical protein HI1480 [103278] (1 protein) Protein Hypothetical protein HI1480 [103279] (1 species) Species Haemophilus influenzae [TaxId:727] [103280] (1 PDB entry)
structural genomics
Domain d1mw5b_: 1mw5 B: [91478]
Details for d1mw5b_
PDB Entry: 1mw5 (more details), 2.1 Å
PDB Description: structure of hi1480 from haemophilus influenzae
SCOP Domain Sequences for d1mw5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mw5b_ d.259.1.1 (B:) Hypothetical protein HI1480 {Haemophilus influenzae}
etdllmkmvrqpvklysvatlfhefsevitklehsvqkeptsllseenwhkqflkfaqal
pahgsaswlnlddalqavvgnsrsaflhqliaklksrhlqvlelnkigsepldlsnlpap
fyvllpesfaaritllvqdkalpyvrvsmeywhaleykgeln
SCOP Domain Coordinates for d1mw5b_:
Click to download the PDB-style file with coordinates for d1mw5b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mw5b_:
- d1mw5b_ first appeared in SCOP 1.67
- d1mw5b_ appears in SCOP 1.71
- d1mw5b_ appears in the current release, SCOPe 2.08, called d1mw5b1
View in 3D
