Lineage for d1mw5b_ (1mw5 B:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 423537Fold d.259: Hypothetical protein HI1480 [103276] (1 superfamily)
    beta-alpha(4)-beta-alpha-beta; segregated alpha-helical and beta-sheet subdomains; dimeric beta-sheet barrel: n=6, S=10
  4. 423538Superfamily d.259.1: Hypothetical protein HI1480 [103277] (1 family) (S)
  5. 423539Family d.259.1.1: Hypothetical protein HI1480 [103278] (1 protein)
  6. 423540Protein Hypothetical protein HI1480 [103279] (1 species)
  7. 423541Species Haemophilus influenzae [TaxId:727] [103280] (1 PDB entry)
    structural genomics
  8. 423543Domain d1mw5b_: 1mw5 B: [91478]
    mutant

Details for d1mw5b_

PDB Entry: 1mw5 (more details), 2.1 Å

PDB Description: structure of hi1480 from haemophilus influenzae

SCOP Domain Sequences for d1mw5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mw5b_ d.259.1.1 (B:) Hypothetical protein HI1480 {Haemophilus influenzae}
etdllmkmvrqpvklysvatlfhefsevitklehsvqkeptsllseenwhkqflkfaqal
pahgsaswlnlddalqavvgnsrsaflhqliaklksrhlqvlelnkigsepldlsnlpap
fyvllpesfaaritllvqdkalpyvrvsmeywhaleykgeln

SCOP Domain Coordinates for d1mw5b_:

Click to download the PDB-style file with coordinates for d1mw5b_.
(The format of our PDB-style files is described here.)

Timeline for d1mw5b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mw5a_