Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (3 families) contains similar fold but lacks its catalytic centre |
Family d.92.2.2: alpha-D-glucuronidase, N-terminal domain [82737] (1 protein) family GH67 |
Protein alpha-D-glucuronidase, N-terminal domain [82738] (2 species) inverting reaction mechanism |
Species Bacillus stearothermophilus [TaxId:1422] [82740] (7 PDB entries) |
Domain d1mqra2: 1mqr A:3-142 [91423] Other proteins in same PDB: d1mqra1 complexed with gol; mutant |
PDB Entry: 1mqr (more details), 2 Å
SCOP Domain Sequences for d1mqra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mqra2 d.92.2.2 (A:3-142) alpha-D-glucuronidase, N-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} agyepcwlryerkdqysrlrfeeivakrtspifqavveelqkglrsmmeiepqvvqevne tansiwlgtledeeferplegtlvhpegyvirsdvddgpfriyiigktdagvlygvfhfl rllqmgeniaqlsiieqpkn
Timeline for d1mqra2: