SCOP 1.67: Domain d1mqra2: 1mqr A:3-142

Lineage for d1mqra2 (1mqr A:3-142)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (2 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.2: alpha-D-glucuronidase, N-terminal domain [82737] (1 protein)
   family GH67

6. Protein alpha-D-glucuronidase, N-terminal domain [82738] (2 species)
   inverting reaction mechanism

7. Species Bacillus stearothermophilus [TaxId:1422] [82740] (7 PDB entries)

8. Domain d1mqra2: 1mqr A:3-142 [91423]
   Other proteins in same PDB: d1mqra1
   complexed with gol; mutant

Details for d1mqra2

PDB Entry: 1mqr, 2 Å

PDB Description: the crystal structure of alpha-d-glucuronidase (e386q) from bacillus stearothermophilus t-6

SCOP Domain Sequences for d1mqra2:

Sequence; same for both SEQRES and ATOM records:

>d1mqra2 d.92.2.2 (A:3-142) alpha-D-glucuronidase, N-terminal domain {Bacillus stearothermophilus}
agyepcwlryerkdqysrlrfeeivakrtspifqavveelqkglrsmmeiepqvvqevne
tansiwlgtledeeferplegtlvhpegyvirsdvddgpfriyiigktdagvlygvfhfl
rllqmgeniaqlsiieqpkn

Timeline for d1mqra2:

• d1mqra2 is new in SCOP 1.67
  
• d1mqra2 appears in SCOP 1.69
  
• d1mqra2 appears in the current release, SCOPe 2.08