SCOP 1.67: Domain d1mjja2: 1mjj A:108-213

Lineage for d1mjja2 (1mjj A:108-213)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)

8. Domain d1mjja2: 1mjj A:108-213 [91295]
   Other proteins in same PDB: d1mjja1, d1mjjb1, d1mjjb2, d1mjjh1, d1mjjh2, d1mjjl1

Details for d1mjja2

PDB Entry: 1mjj, 2.1 Å

PDB Description: high resolution crystal structure of the complex of the fab fragment of esterolytic antibody ms6-12 and a transition-state analog

SCOP Domain Sequences for d1mjja2:

Sequence; same for both SEQRES and ATOM records:

>d1mjja2 b.1.1.2 (A:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d1mjja2:

• d1mjja2 is new in SCOP 1.67
  
• d1mjja2 appears in SCOP 1.69
  
• d1mjja2 appears in the current release, SCOPe 2.08