Lineage for d1mjjb2 (1mjj B:114-228)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365019Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 365143Species Mouse (Mus musculus) [TaxId:10090] [88576] (287 PDB entries)
  8. 365189Domain d1mjjb2: 1mjj B:114-228 [91297]
    Other proteins in same PDB: d1mjja1, d1mjja2, d1mjjb1, d1mjjh1, d1mjjl1, d1mjjl2

Details for d1mjjb2

PDB Entry: 1mjj (more details), 2.1 Å

PDB Description: high resolution crystal structure of the complex of the fab fragment of esterolytic antibody ms6-12 and a transition-state analog

SCOP Domain Sequences for d1mjjb2:

Sequence, based on SEQRES records: (download)

>d1mjjb2 b.1.1.2 (B:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttapsvyplapvcgdtsgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

Sequence, based on observed residues (ATOM records): (download)

>d1mjjb2 b.1.1.2 (B:114-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttapsvyplapvcssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytls
ssvtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOP Domain Coordinates for d1mjjb2:

Click to download the PDB-style file with coordinates for d1mjjb2.
(The format of our PDB-style files is described here.)

Timeline for d1mjjb2: