Lineage for d1mj5a_ (1mj5 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1615834Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 1615835Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 1616432Family c.69.1.8: Haloalkane dehalogenase [53513] (2 proteins)
  6. 1616433Protein Haloalkane dehalogenase [53514] (3 species)
  7. 1616438Species Sphingomonas paucimobilis, UT26, LinB [TaxId:13689] [53517] (12 PDB entries)
  8. 1616439Domain d1mj5a_: 1mj5 A: [91285]
    complexed with cl, mg

Details for d1mj5a_

PDB Entry: 1mj5 (more details), 0.95 Å

PDB Description: LINB (haloalkane dehalogenase) from sphingomonas paucimobilis UT26 at atomic resolution
PDB Compounds: (A:) 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase

SCOPe Domain Sequences for d1mj5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]}
slgakpfgekkfieikgrrmayidegtgdpilfqhgnptssylwrnimphcaglgrliac
dligmgdsdkldpsgperyayaehrdyldalwealdlgdrvvlvvhdwgsalgfdwarrh
rervqgiaymeaiampiewadfpeqdrdlfqafrsqageelvlqdnvfveqvlpglilrp
lseaemaayrepflaagearrptlswprqipiagtpadvvaiardyagwlsespipklfi
naepgalttgrmrdfcrtwpnqteitvagahfiqedspdeigaaiaafvrrlrpahhh

SCOPe Domain Coordinates for d1mj5a_:

Click to download the PDB-style file with coordinates for d1mj5a_.
(The format of our PDB-style files is described here.)

Timeline for d1mj5a_: