Lineage for d1m76b1 (1m76 B:204-302)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2334421Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 2334422Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 2334484Family a.100.1.3: HCDH C-domain-like [48187] (2 proteins)
  6. 2334503Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [48188] (2 species)
    Dimer of 5-helical motifs; similar to duplicated motifs of 6PGD and KARI
  7. 2334504Species Human (Homo sapiens) [TaxId:9606] [48189] (11 PDB entries)
  8. 2334512Domain d1m76b1: 1m76 B:204-302 [91218]
    Other proteins in same PDB: d1m76a2, d1m76b2
    complexed with caa, nad; mutant

Details for d1m76b1

PDB Entry: 1m76 (more details), 2.15 Å

PDB Description: crystal structure of the s137c mutant of l-3-hydroxyacyl-coa dehydrogenase in complex with nad and acetoacetyl-coa
PDB Compounds: (B:) 3-hydroxyacyl-CoA dehydrogenase

SCOPe Domain Sequences for d1m76b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m76b1 a.100.1.3 (B:204-302) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]}
gfivnrllvpylmeairlyergdaskedidtamklgagypmgpfelldyvgldttkfivd
gwhemdaenplhqpspslnklvaenkfgkktgegfykyk

SCOPe Domain Coordinates for d1m76b1:

Click to download the PDB-style file with coordinates for d1m76b1.
(The format of our PDB-style files is described here.)

Timeline for d1m76b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m76b2