Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
Protein Short chain L-3-hydroxyacyl CoA dehydrogenase [51874] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [51875] (11 PDB entries) |
Domain d1m75b2: 1m75 B:12-203 [91215] Other proteins in same PDB: d1m75a1, d1m75b1 complexed with caa, nad; mutant |
PDB Entry: 1m75 (more details), 2.3 Å
SCOPe Domain Sequences for d1m75b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m75b2 c.2.1.6 (B:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} kiivkhvtviggglmgagiaqvaaatghtvvlvdqtedilakskkgieeslrkvakkkfa enpkagdefvektlstiatstdaasvvhstdlvveaivenlkvknelfkrldkfaaehti fasntsslqitsianattrqdrfaglhffnpvpvmklveviktpmtsqktfeslvdfska lgkhpvsckdtp
Timeline for d1m75b2: