SCOPe 2.07: Domain d1m6zb1: 1m6z B:1-92

Lineage for d1m6zb1 (1m6z B:1-92)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.4: Two-domain cytochrome c [46680] (3 proteins)
   duplication: consists of two cytochrome c type domains

6. Protein Cytochrome c4 [46681] (2 species)

7. Species Pseudomonas stutzeri [TaxId:316] [46682] (3 PDB entries)

8. Domain d1m6zb1: 1m6z B:1-92 [91194]
   complexed with gol, hec, trs

Details for d1m6zb1

PDB Entry: 1m6z, 1.35 Å

PDB Description: crystal structure of reduced recombinant cytochrome c4 from pseudomonas stutzeri

PDB Compounds: (B:) cytochrome c4

SCOPe Domain Sequences for d1m6zb1:

Sequence; same for both SEQRES and ATOM records:

>d1m6zb1 a.3.1.4 (B:1-92) Cytochrome c4 {Pseudomonas stutzeri [TaxId: 316]}
agdaeagqgkvavcgachgvdgnspapnfpklagqgeryllkqlqdikagstpgapegvg
rkvlemtgmldplsdqdlediaayfssqkgsv

Timeline for d1m6zb1:

• d1m6zb1 first appeared in SCOP 1.67
  
• d1m6zb1 appears in SCOPe 2.06
  
• d1m6zb1 appears in the current release, SCOPe 2.08