Class b: All beta proteins [48724] (149 folds) |
Fold b.34: SH3-like barrel [50036] (15 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (1 family) |
Family b.34.2.1: SH3-domain [50045] (37 proteins) |
Protein C-Crk, N-terminal SH3 domain [50046] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [50047] (7 PDB entries) |
Domain d1m3ba_: 1m3b A: [91174] a circular form mutant |
PDB Entry: 1m3b (more details)
SCOP Domain Sequences for d1m3ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m3ba_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus)} cgyvralfdfngndeedlpfkkgdilrirdkpeeqwwnaedsegkrgmipvpyvekyg
Timeline for d1m3ba_: