Lineage for d1m3ba_ (1m3b A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 557280Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 557332Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 557333Family b.34.2.1: SH3-domain [50045] (37 proteins)
  6. 557388Protein C-Crk, N-terminal SH3 domain [50046] (1 species)
  7. 557389Species Mouse (Mus musculus) [TaxId:10090] [50047] (7 PDB entries)
  8. 557395Domain d1m3ba_: 1m3b A: [91174]
    a circular form
    mutant

Details for d1m3ba_

PDB Entry: 1m3b (more details)

PDB Description: solution structure of a circular form of the n-terminal sh3 domain (a134c, e135g, r191g mutant) from oncogene protein c-crk.

SCOP Domain Sequences for d1m3ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m3ba_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus)}
cgyvralfdfngndeedlpfkkgdilrirdkpeeqwwnaedsegkrgmipvpyvekyg

SCOP Domain Coordinates for d1m3ba_:

Click to download the PDB-style file with coordinates for d1m3ba_.
(The format of our PDB-style files is described here.)

Timeline for d1m3ba_: