PDB entry 1m3b

View 1m3b on RCSB PDB site
Description: solution structure of a circular form of the n-terminal sh3 domain (a134c, e135g, r191g mutant) from oncogene protein c-crk.
Deposited on 2002-06-27, released 2003-08-05
The last revision prior to the SCOP 1.71 freeze date was dated 2003-08-05, with a file datestamp of 2003-08-05.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.97 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1m3ba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1m3bA (A:)
    cgyvralfdfngndeedlpfkkgdilrirdkpeeqwwnaedsegkrgmipvpyvekyg