Lineage for d1lvnb4 (1lvn B:6-90)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1033660Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 1033661Superfamily d.82.1: Copper amine oxidase, domain N [55383] (1 family) (S)
  5. 1033662Family d.82.1.1: Copper amine oxidase, domain N [55384] (1 protein)
  6. 1033663Protein Copper amine oxidase, domain N [55385] (1 species)
    non-conserved N-terminal domain
  7. 1033664Species Escherichia coli [TaxId:562] [55386] (11 PDB entries)
  8. 1033684Domain d1lvnb4: 1lvn B:6-90 [91145]
    Other proteins in same PDB: d1lvna1, d1lvna2, d1lvna3, d1lvnb1, d1lvnb2, d1lvnb3
    complexed with ca, cu

Details for d1lvnb4

PDB Entry: 1lvn (more details), 2.4 Å

PDB Description: crystal structure of e. coli amine oxidase complexed with tranylcypromine
PDB Compounds: (B:) copper amine oxidase

SCOPe Domain Sequences for d1lvnb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lvnb4 d.82.1.1 (B:6-90) Copper amine oxidase, domain N {Escherichia coli [TaxId: 562]}
hmvpmdktlkefgadvqwddyaqlftlikdgayvkvkpgaqtaivngqplalqvpvvmkd
nkawvsdtfindvfqsgldqtfqve

SCOPe Domain Coordinates for d1lvnb4:

Click to download the PDB-style file with coordinates for d1lvnb4.
(The format of our PDB-style files is described here.)

Timeline for d1lvnb4: