SCOPe 2.01: Domain d1l2ga_: 1l2g A:

Lineage for d1l2ga_ (1l2g A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein HSV glycoprotein D [63637] (1 species)

7. Species Herpes simplex virus type 1 [TaxId:10298] [63638] (2 PDB entries)
   elaborated with insertions and N- and C-terminal extensions

8. Domain d1l2ga_: 1l2g A: [91048]
   complexed with nag

Details for d1l2ga_

PDB Entry: 1l2g, 2.85 Å

PDB Description: structure of a c-terminally truncated form of glycoprotein d from hsv- 1

PDB Compounds: (A:) glycoprotein d

SCOPe Domain Sequences for d1l2ga_:

Sequence; same for both SEQRES and ATOM records:

>d1l2ga_ b.1.1.1 (A:) HSV glycoprotein D {Herpes simplex virus type 1 [TaxId: 10298]}
pnrfrgkdlpvldqltdppgvrrvyhiqaglpdpfqppslpitvyyavleracrsvllna
pseapqivrgasedvrkqpynltiawfrmggncaipitvmeytecsynkslgacpirtqp
rwnyydsfsavsednlgflmhapafetagtylrlvkindwteitqfilehrakgsckyal
plrippsaclspqayqqgvtvdsigmlprfipenqrtvavyslkiagwhgpkapytstll
pp

Timeline for d1l2ga_:

• d1l2ga_ first appeared in SCOP 1.67
  
• d1l2ga_ appears in SCOP 1.75
  
• d1l2ga_ appears in SCOPe 2.02
  
• d1l2ga_ appears in the current release, SCOPe 2.08