Lineage for d1ktvb3 (1ktv B:476-599)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2537230Family d.14.1.1: Translational machinery components [54212] (5 proteins)
  6. 2537260Protein Elongation factor G (EF-G), domain IV [54213] (2 species)
  7. 2537261Species Thermus thermophilus [TaxId:274] [54214] (9 PDB entries)
  8. 2537271Domain d1ktvb3: 1ktv B:476-599 [91033]
    Other proteins in same PDB: d1ktva1, d1ktva2, d1ktva4, d1ktvb1, d1ktvb2, d1ktvb4

Details for d1ktvb3

PDB Entry: 1ktv (more details), 3.8 Å

PDB Description: crystal structure of elongation factor g dimer without nucleotide
PDB Compounds: (B:) Elongation factor G

SCOPe Domain Sequences for d1ktvb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ktvb3 d.14.1.1 (B:476-599) Elongation factor G (EF-G), domain IV {Thermus thermophilus [TaxId: 274]}
vgkpqvayretitkpvdvegkfirqtggrgqyghvkikveplprgsgfefvnaivggvip
keyipavqkgieeamqsgpligfpvvdikvtlydgsyhevdssemafkiagsmaikeavq
kgdp

SCOPe Domain Coordinates for d1ktvb3:

Click to download the PDB-style file with coordinates for d1ktvb3.
(The format of our PDB-style files is described here.)

Timeline for d1ktvb3: