Lineage for d1kpoy2 (1kpo Y:191-366)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 979734Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 979893Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 979894Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)
  6. 979895Protein GroEL, A domain [52031] (4 species)
  7. 979896Species Escherichia coli [TaxId:562] [52032] (16 PDB entries)
  8. 980004Domain d1kpoy2: 1kpo Y:191-366 [91013]
    Other proteins in same PDB: d1kpo11, d1kpo13, d1kpo21, d1kpo23, d1kpoo1, d1kpoo3, d1kpop1, d1kpop3, d1kpoq1, d1kpoq3, d1kpor1, d1kpor3, d1kpos1, d1kpos3, d1kpot1, d1kpot3, d1kpou1, d1kpou3, d1kpov1, d1kpov3, d1kpow1, d1kpow3, d1kpox1, d1kpox3, d1kpoy1, d1kpoy3, d1kpoz1, d1kpoz3

Details for d1kpoy2

PDB Entry: 1kpo (more details), 3.52 Å

PDB Description: Structural and mechanistic basis for allostery in the bacterial chaperonin GroEL; see remark 400
PDB Compounds: (Y:) groEL protein

SCOPe Domain Sequences for d1kpoy2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kpoy2 c.8.5.1 (Y:191-366) GroEL, A domain {Escherichia coli [TaxId: 562]}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

SCOPe Domain Coordinates for d1kpoy2:

Click to download the PDB-style file with coordinates for d1kpoy2.
(The format of our PDB-style files is described here.)

Timeline for d1kpoy2: