Lineage for d1kfjb_ (1kfj B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1182707Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 1182708Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 1182709Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 1182873Protein Tryptophan synthase, beta-subunit [53688] (2 species)
  7. 1182885Species Salmonella typhimurium [TaxId:90371] [53689] (37 PDB entries)
  8. 1182896Domain d1kfjb_: 1kfj B: [90959]
    Other proteins in same PDB: d1kfja_
    complexed with na, pls

Details for d1kfjb_

PDB Entry: 1kfj (more details), 1.8 Å

PDB Description: crystal structure of wild-type tryptophan synthase complexed with l-serine
PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d1kfjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kfjb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlsgrgdkdiftvhdilkarg

SCOPe Domain Coordinates for d1kfjb_:

Click to download the PDB-style file with coordinates for d1kfjb_.
(The format of our PDB-style files is described here.)

Timeline for d1kfjb_: