Lineage for d1kbna1 (1kbn A:77-209)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1089232Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1089233Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1089234Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 1089512Protein Class pi GST [81347] (4 species)
  7. 1089513Species Human (Homo sapiens) [TaxId:9606] [47619] (41 PDB entries)
  8. 1089560Domain d1kbna1: 1kbn A:77-209 [90947]
    Other proteins in same PDB: d1kbna2, d1kbnb2
    complexed with gol, gsh, mes; mutant

Details for d1kbna1

PDB Entry: 1kbn (more details), 2 Å

PDB Description: glutathione transferase mutant
PDB Compounds: (A:) Glutathione S-transferase P

SCOPe Domain Sequences for d1kbna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbna1 a.45.1.1 (A:77-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
glygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqn
qggktfivgdqasfadanlldlllihevlapgcldafpllsayvgrlsarpklkaflasp
eyvnlpingngkq

SCOPe Domain Coordinates for d1kbna1:

Click to download the PDB-style file with coordinates for d1kbna1.
(The format of our PDB-style files is described here.)

Timeline for d1kbna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1kbna2